Structure of PDB 8fkx Chain SJ

Receptor sequence
>8fkxSJ (length=219) Species: 9606 (Homo sapiens) [Search protein sequence]
AVLQEEQANLWFSKGSFAGIEDDADEALEISQAQLLFENRRKGHRILDPE
GLALGAVIASSKKAKRDLIDNSFNRYTFNEDEGELPEWFVQEEKQHRIRQ
LPVGKKEVEHYRKRWREINARPIKKVAEAKARKKRRMLKRLEQTRKKAEA
VVNTVDISEREKVAQLRSLYKKAGLGKEKRHVTYVVAKKPAGVRGHFKVV
DSRMKKDQRAQQRKEQKKK
3D structure
PDB8fkx Principles of human pre-60 S biogenesis.
ChainSJ
Resolution2.59 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.1.1.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SJ R691 R715 A736 R737 R776 K778 Q781 R783 K787 V798 Y800 D825 S826 R827 K829 K830 D831 Q832 R833 R75 R99 A120 R121 R160 K162 Q165 R167 K171 V182 Y184 D201 S202 R203 K205 K206 D207 Q208 R209
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008168 methyltransferase activity
GO:0008649 rRNA methyltransferase activity
GO:0008650 rRNA (uridine-2'-O-)-methyltransferase activity
GO:0016435 rRNA (guanine) methyltransferase activity
GO:0062105 RNA 2'-O-methyltransferase activity
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0001510 RNA methylation
GO:0006364 rRNA processing
GO:0031167 rRNA methylation
GO:0032259 methylation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0030687 preribosome, large subunit precursor
GO:0030688 preribosome, small subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8fkx, PDBe:8fkx, PDBj:8fkx
PDBsum8fkx
PubMed37410842
UniProtQ8IY81|SPB1_HUMAN pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3 (Gene Name=FTSJ3)

[Back to BioLiP]