Structure of PDB 7wtq Chain SJ

Receptor sequence

>7wtqSJ (length=185) Species: 4932 (Saccharomyces cerevisiae)

PRAPRTYSKTYSTPKRPYESSRLDAELKLAGEFGLKNKKEIYRISFQLSK
IRRAARDLLTRDEKDPKRLFEGNALIRRLVRVGVLSEDKKKLDYVLALKV
EDFLERRLQTQVYKLGLAKSVHHARVLITQRHIAVGKQIVNIPSFMVRLD
SEKHIDFAPTSPFGGARPGRVARRNAARKAEASGE

3D structure

• PDB: 7wtq The nucleoplasmic phase of pre-40S formation prior to nuclear export.
• Chain: SJ
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SJ	P2 R3 P5 R6 T7 Y8 S9 K10 T11 Y12 T14 K16 R17 Y19 K37 N38 K39 K40 R44 S50 R54 R57 A75 R78 S121 H124 T130 Q131 R132 H133 Q139 I143 P144 S145 F146 R149 S152 P163 R168 G170 R171 V172 A173 R175 N176	P1 R2 P4 R5 T6 Y7 S8 K9 T10 Y11 T13 K15 R16 Y18 K36 N37 K38 K39 R43 S49 R53 R56 A74 R77 S120 H123 T129 Q130 R131 H132 Q138 I142 P143 S144 F145 R148 S151 P162 R167 G169 R170 V171 A172 R174 N175

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006364 rRNA processing
• GO:0006412 translation
• GO:0042254 ribosome biogenesis
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:0030686 90S preribosome
• GO:0032040 small-subunit processome
• GO:0043226 organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7wtq, PDBe:7wtq, PDBj:7wtq
• PDBsum: 7wtq
• PubMed: 36321656
• UniProt: O13516|RS9A_YEAST Small ribosomal subunit protein uS4A (Gene Name=RPS9A)