Structure of PDB 8rxh Chain SI

Receptor sequence

>8rxhSI (length=200) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

MQPHLRKLRKLKRGKPSDLEESVAKALFELEASHKTLRQELPRFHVNTVR
EVKVPRSKKTVLVVFYPLRFLMLVRKVQRALTSELEKRHPGCLVMLVAQR
QITKRPTDVYKLQKVQRSKTSTAVFENILNDMIYPSDVVGRRWRCRTDGS
KLMKVFLDARDRKRIESRLRAVAYVYKQLTHRRVSFGFMWNPKLQQVSTR

3D structure

PDB

8rxh Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.93 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SI	R9 K10 L11 K12 H34 R43 R50 K59 L68 R69 M72 L73 K76 S83 E84 G91 Q99 R100 Q101 I102 K104 R105 D108 V109 Y110 L112 Q113 Q116 R117 S118 K119 T120 S121 T122 D148 K151 K177 L179 H181 R183 W190 S198 T199	R9 K10 L11 K12 H34 R43 R50 K59 L68 R69 M72 L73 K76 S83 E84 G91 Q99 R100 Q101 I102 K104 R105 D108 V109 Y110 L112 Q113 Q116 R117 S118 K119 T120 S121 T122 D148 K151 K177 L179 H181 R183 W190 S198 T199

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006364	rRNA processing
GO:0006412	translation
GO:0042274	ribosomal small subunit biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0032040	small-subunit processome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8rxh, PDBe:8rxh, PDBj:8rxh
PDBsum	8rxh
PubMed	38722744
UniProt	E9AC32

[Back to BioLiP]