Structure of PDB 8oo0 Chain SI

Receptor sequence

>8oo0SI (length=201) Species: 209285 (Thermochaetoides thermophila) [Search protein sequence]

GISRDSRHKRSHTGAKRAFYRKKRAFELGRQPANTRIGPKRIHIVRTRGG
NHKYRALRLDSGNFAWGSEGCTRKTRIIGVVYHPSNNELVRTNTLTKSAV
VQIDAAPFRQWYEAHYGQPLGRRRQQKQGQVVEEVKKSKSVEKKQAARFA
AHGKVDPALEKQFEAGRLYAIISSRPGQSGRADGYILEGEELAFYQRKLH
K

3D structure

PDB

8oo0 Methionine aminopeptidase 2 and its autoproteolysis product have different binding sites on the ribosome.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SI	R77 E89 K128 A166 R168 K202	R76 E88 K127 A165 R167 K201
BS02	rna	SI	G2 R5 K10 R11 Y21 R22 K23 K24 R25 A26 R31 K41 R42 R47 T48 R49 G50 R56 N64 T73 S86 K98 S99 K138 R149 S174 R176 Q179 R182 D184	G1 R4 K9 R10 Y20 R21 K22 K23 R24 A25 R30 K40 R41 R46 T47 R48 G49 R55 N63 T72 S85 K97 S98 K137 R148 S173 R175 Q178 R181 D183

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8oo0, PDBe:8oo0, PDBj:8oo0
PDBsum	8oo0
PubMed	38267453
UniProt	G0RY45

[Back to BioLiP]