Structure of PDB 8k2a Chain SI

Receptor sequence

>8k2aSI (length=304) Species: 9606 (Homo sapiens)

EDFIKKQIEEFNIGKRHLANMMGEDPETFTQEDIDRAIAYLFPSGLFEKR
ARPVMKHPEQIFPRQRAIQWGEDGRPFHYLFYTGKQSYYSLMHDVYGMLL
NLEKHQRWLIKEELEEMLVEKLSDLDYMQFIRLLEKLLTSQCGAAEEEFV
QRFRRSVTLESKKQLIEPVQYDEQGMAFSKSEGKRKTAKAEAIVYKHGSG
RIKVNGIDYQLYFPITQDREQLMFPFHFVDRLGKHDVTCTVSGGGRSAQA
GAIRLAMAKALCSFVTEDEVEWMRQAGLLTTDPRVRERKKPGQEGARRKF
TWKK

3D structure

• PDB: 8k2a Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
• Chain: SI
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SI	F117 E118 S214 L216 Q220 R276 K277 T278 G336 R337 S338 A339 R375 V376 R377 E378 K380 K381 P382 G383 G386 R388 R389 F391 T392 W393 K394	F47 E48 S123 L125 Q129 R185 K186 T187 G245 R246 S247 A248 R284 V285 R286 E287 K289 K290 P291 G292 G295 R297 R298 F300 T301 W302 K303

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005730 nucleolus
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8k2a, PDBe:8k2a, PDBj:8k2a
• PDBsum: 8k2a
• PubMed: 38942792
• UniProt: P82933|RT09_HUMAN Small ribosomal subunit protein uS9m (Gene Name=MRPS9)