Structure of PDB 7z3o Chain SI

Receptor sequence

>7z3oSI (length=201) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

GISRDSRHKRSHTGAKRAFYRKKRAFELGRQPANTRIGPKRIHIVRTRGG
NHKYRALRLDSGNFAWGSEGCTRKTRIIGVVYHPSNNELVRTNTLTKSAV
VQIDAAPFRQWYEAHYGQPLGRRRQQKQGQVVEEVKKSKSVEKKQAARFA
AHGKVDPALEKQFEAGRLYAIISSRPGQSGRADGYILEGEELAFYQRKLH
K

3D structure

PDB

7z3o Structural inventory of cotranslational protein folding by the eukaryotic RAC complex.

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SI	R77 R92 K128 A166 R168 K202	R76 R91 K127 A165 R167 K201
BS02	rna	SI	G2 R5 K10 R11 H13 Y21 R22 K23 K24 R25 A26 F27 L29 R31 K41 R42 H44 R47 T48 R49 G50 K54 Y55 R56 N64 T73 R74 K75 S86 K98 S99 K138 K140 S174 R176 Q179 S180 R182 D184	G1 R4 K9 R10 H12 Y20 R21 K22 K23 R24 A25 F26 L28 R30 K40 R41 H43 R46 T47 R48 G49 K53 Y54 R55 N63 T72 R73 K74 S85 K97 S98 K137 K139 S173 R175 Q178 S179 R181 D183

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7z3o, PDBe:7z3o, PDBj:7z3o
PDBsum	7z3o
PubMed	37081320
UniProt	G0RY45

[Back to BioLiP]