Structure of PDB 7wtn Chain SI

Receptor sequence

>7wtnSI (length=188) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

GISRDSRHKRSATGAKRAQFRKKRKFELGRQPANTKIGAKRIHSVRTRGG
NKKYRALRIETGNFSWASEGISKKTRIAGVVYHPSNNELVRTNTLTKAAI
VQIDATPFRQWFEAHYGQTLGKKSKNAERKWAARAASAKIESSVESQFSA
GRLYACISSRPGQSGRCDGYILEGEELAFYLRRLTAKK

3D structure

PDB

7wtn The nucleoplasmic phase of pre-40S formation prior to nuclear export.

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SI	G2 I3 R5 R8 H9 K10 R11 T14 A16 R22 K23 K24 R25 K26 F27 G30 R31 Q32 P33 R42 I43 H44 R47 T48 R49 G50 K54 R56 L58 N64 S73 S86 N87 T97 K98 K137 N138 R141 K142 R146 S170 R172 Q175 S176 R178 D180	G1 I2 R4 R7 H8 K9 R10 T13 A15 R21 K22 K23 R24 K25 F26 G29 R30 Q31 P32 R41 I42 H43 R46 T47 R48 G49 K53 R55 L57 N63 S72 S85 N86 T96 K97 K125 N126 R129 K130 R134 S158 R160 Q163 S164 R166 D168

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0030686	90S preribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7wtn, PDBe:7wtn, PDBj:7wtn
PDBsum	7wtn
PubMed	36321656
UniProt	P0CX39\|RS8A_YEAST Small ribosomal subunit protein eS8A (Gene Name=RPS8A)

[Back to BioLiP]