Structure of PDB 7wtm Chain SI

Receptor sequence

>7wtmSI (length=188) Species: 4932 (Saccharomyces cerevisiae)

GISRDSRHKRSATGAKRAQFRKKRKFELGRQPANTKIGAKRIHSVRTRGG
NKKYRALRIETGNFSWASEGISKKTRIAGVVYHPSNNELVRTNTLTKAAI
VQIDATPFRQWFEAHYGQTLGKKSKNAERKWAARAASAKIESSVESQFSA
GRLYACISSRPGQSGRCDGYILEGEELAFYLRRLTAKK

3D structure

• PDB: 7wtm In vitro structural maturation of an early stage pre-40S particle coupled with U3 snoRNA release and central pseudoknot formation.
• Chain: SI
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SI	G2 R5 R8 K10 R11 A13 T14 G15 A16 R18 F21 R22 K23 K24 R25 K26 F27 R31 P33 A34 K41 R42 I43 R47 T48 R49 G50 K54 R56 N64 S73 S86 T97 K98 K137 N138 K142 S170 R172 Q175 S176 R178 D180	G1 R4 R7 K9 R10 A12 T13 G14 A15 R17 F20 R21 K22 K23 R24 K25 F26 R30 P32 A33 K40 R41 I42 R46 T47 R48 G49 K53 R55 N63 S72 S85 T96 K97 K125 N126 K130 S158 R160 Q163 S164 R166 D168

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0030686 90S preribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7wtm, PDBe:7wtm, PDBj:7wtm
• PDBsum: 7wtm
• PubMed: 36263816
• UniProt: P0CX39|RS8A_YEAST Small ribosomal subunit protein eS8A (Gene Name=RPS8A)