Structure of PDB 7cpu Chain SI

Receptor sequence

>7cpuSI (length=183) Species: 10090 (Mus musculus)

GISRDNWHKRRKTGGKRKPYHKKRKYELGRPAANTKIGPRRIHTVRVRGG
NKKYRALRLDVGNFSWGSECCTRKTRIIDVVYNASNNELVRTKTLVKNCI
VLIDSTPYRQWYESHYALPLGSKKIQKKYDERKKNAKISSLLEEQFQQGK
LLACIASRPGQCGRADGYVLEGKELEFYLRKIK

3D structure

• PDB: 7cpu A male germ-cell-specific ribosome controls male fertility.
• Chain: SI
• Resolution: 2.82 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SI	G2 R5 D6 N7 H9 K10 R11 R12 K13 T14 G15 K17 K19 Y21 H22 K23 K24 R25 K26 Y27 L29 G30 R31 A33 R42 H44 R47 V48 R49 G50 N52 K54 R56 N64 C71 T73 R74 K75 S86 V97 K98 N99 A176 R178 Q181 R184 D186 G187 Y188	G1 R4 D5 N6 H8 K9 R10 R11 K12 T13 G14 K16 K18 Y20 H21 K22 K23 R24 K25 Y26 L28 G29 R30 A32 R41 H43 R46 V47 R48 G49 N51 K53 R55 N63 C70 T72 R73 K74 S85 V96 K97 N98 A156 R158 Q161 R164 D166 G167 Y168

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005783 endoplasmic reticulum
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0016020 membrane
• GO:0022626 cytosolic ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0032040 small-subunit processome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7cpu, PDBe:7cpu, PDBj:7cpu
• PDBsum: 7cpu
• PubMed: 36517592
• UniProt: P62242|RS8_MOUSE Small ribosomal subunit protein eS8 (Gene Name=Rps8)