Structure of PDB 8yop Chain SH

Receptor sequence
>8yopSH (length=186) Species: 9606 (Homo sapiens) [Search protein sequence]
SAKIVKPNGEKPDEFESGISQALLELEMNSDLKAQLRELNITAAKEIEVG
GGRKAIIIFVPVPQLKSFQKIQVRLVRELEKKFSGKHVVFIAQRRILPKP
TRKKNKQKRPRSRTLTAVHDAILEDLVFPSEIVGKRIRVKLDGSRLIKVH
LDKAQQNNVEHKVETFSGVYKKLTGKDVNFEFPEFQ
3D structure
PDB8yop Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
ChainSH
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SH R98 R99 K103 T105 R106 K107 K111 K113 Q114 K115 R116 R118 S119 R120 T121 L122 T123 R94 R95 K99 T101 R102 K103 K104 K106 Q107 K108 R109 R111 S112 R113 T114 L115 T116
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003730 mRNA 3'-UTR binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019901 protein kinase binding
GO:0048027 mRNA 5'-UTR binding
GO:1990948 ubiquitin ligase inhibitor activity
Biological Process
GO:0001843 neural tube closure
GO:0002181 cytoplasmic translation
GO:0006364 rRNA processing
GO:0006412 translation
GO:0010628 positive regulation of gene expression
GO:0014033 neural crest cell differentiation
GO:0042274 ribosomal small subunit biogenesis
GO:0050821 protein stabilization
GO:1902255 positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator
GO:1904667 negative regulation of ubiquitin protein ligase activity
GO:2000059 negative regulation of ubiquitin-dependent protein catabolic process
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005813 centrosome
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005856 cytoskeleton
GO:0005925 focal adhesion
GO:0016020 membrane
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0032040 small-subunit processome
GO:0032991 protein-containing complex
GO:0045202 synapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8yop, PDBe:8yop, PDBj:8yop
PDBsum8yop
PubMed38942792
UniProtP62081|RS7_HUMAN Small ribosomal subunit protein eS7 (Gene Name=RPS7)

[Back to BioLiP]