Structure of PDB 8fld Chain SH

Receptor sequence

>8fldSH (length=150) Species: 9606 (Homo sapiens) [Search protein sequence]

LTPGVVYVRHLPNLLDETQIFSYFSQFGTVTRFRLSRSKRTGNSKGYAFV
EFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFKQP
SYPSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLILQ

3D structure

PDB

8fld Principles of human pre-60S biogenesis

Chain

Resolution

2.58 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SH	Y48 R50 H51 R75 L76 S77 R78 S79 R81 T82 N84 K86 Y88 F90 E113 R114 H127 E129 L130 K132 D133 F138 K139 P141 S142 P144 S145 R148 Y149 R153 M161 R164 K168	Y7 R9 H10 R34 L35 S36 R37 S38 R40 T41 N43 K45 Y47 F49 E72 R73 H86 E88 L89 K91 D92 F97 K98 P100 S101 P103 S104 R107 Y108 R112 M120 R123 K127

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0005515	protein binding

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0009303	rRNA transcription
GO:0016072	rRNA metabolic process
GO:0065003	protein-containing complex assembly

	Cellular Component
GO:0000794	condensed nuclear chromosome
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005694	chromosome
GO:0005730	nucleolus
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8fld, PDBe:8fld, PDBj:8fld
PDBsum	8fld
PubMed	37410842
UniProt	Q9BYG3\|MK67I_HUMAN MKI67 FHA domain-interacting nucleolar phosphoprotein (Gene Name=NIFK)

[Back to BioLiP]