Structure of PDB 8fkz Chain SH

Receptor sequence
>8fkzSH (length=150) Species: 9606 (Homo sapiens) [Search protein sequence]
LTPGVVYVRHLPNLLDETQIFSYFSQFGTVTRFRLSRSKRTGNSKGYAFV
EFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFKQP
SYPSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLILQ
3D structure
PDB8fkz Principles of human pre-60 S biogenesis.
ChainSH
Resolution3.04 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SH R50 H51 R75 S77 R78 S79 T82 K86 G87 Y88 E113 R114 H127 E129 L130 K132 F138 S142 P144 S145 Y149 R9 H10 R34 S36 R37 S38 T41 K45 G46 Y47 E72 R73 H86 E88 L89 K91 F97 S101 P103 S104 Y108
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0009303 rRNA transcription
GO:0016072 rRNA metabolic process
GO:0065003 protein-containing complex assembly
Cellular Component
GO:0000794 condensed nuclear chromosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8fkz, PDBe:8fkz, PDBj:8fkz
PDBsum8fkz
PubMed37410842
UniProtQ9BYG3|MK67I_HUMAN MKI67 FHA domain-interacting nucleolar phosphoprotein (Gene Name=NIFK)

[Back to BioLiP]