Structure of PDB 8fkx Chain SH

Receptor sequence

>8fkxSH (length=150) Species: 9606 (Homo sapiens)

LTPGVVYVRHLPNLLDETQIFSYFSQFGTVTRFRLSRSKRTGNSKGYAFV
EFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFKQP
SYPSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLILQ

3D structure

• PDB: 8fkx Principles of human pre-60 S biogenesis.
• Chain: SH
• Resolution: 2.59 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SH	R50 H51 R75 L76 S77 R78 S79 R81 T82 N84 K86 Y88 F90 E113 R114 H127 E129 L130 F138 K139 S142 P144 S145 R148 Y149 R153 M161 R164 K168 K179	R9 H10 R34 L35 S36 R37 S38 R40 T41 N43 K45 Y47 F49 E72 R73 H86 E88 L89 F97 K98 S101 P103 S104 R107 Y108 R112 M120 R123 K127 K138

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0005515 protein binding

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0009303 rRNA transcription
• GO:0016072 rRNA metabolic process
• GO:0065003 protein-containing complex assembly

Cellular Component

• GO:0000794 condensed nuclear chromosome
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005694 chromosome
• GO:0005730 nucleolus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:8fkx, PDBe:8fkx, PDBj:8fkx
• PDBsum: 8fkx
• PubMed: 37410842
• UniProt: Q9BYG3|MK67I_HUMAN MKI67 FHA domain-interacting nucleolar phosphoprotein (Gene Name=NIFK)