Structure of PDB 7n30 Chain SH

Receptor sequence
>7n30SH (length=128) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
MQDPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKVE
GDTKPELELTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGIA
VVSTSKGVMTDRAARQAGLGGEIICYVA
3D structure
PDB7n30 Structural basis of early translocation events on the ribosome.
ChainSH
Resolution2.66 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna SH M3 Q4 P6 D9 T12 R13 R15 N16 A20 K22 S30 K31 K56 R80 P81 G82 Y86 R88 K89 S105 T106 S107 K108 G120 G122 E124 M1 Q2 P4 D7 T10 R11 R13 N14 A18 K20 S28 K29 K54 R78 P79 G80 Y84 R86 K87 S103 T104 S105 K106 G118 G120 E122
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006417 regulation of translation
GO:0043488 regulation of mRNA stability
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7n30, PDBe:7n30, PDBj:7n30
PDBsum7n30
PubMed34234344
UniProtP0A7W7|RS8_ECOLI Small ribosomal subunit protein uS8 (Gene Name=rpsH)

[Back to BioLiP]