Structure of PDB 6lqs Chain SH

Receptor sequence

>6lqsSH (length=182) Species: 559292 (Saccharomyces cerevisiae S288C)

MKLNISYPVNGSQKTFEIDDEHRIRVFFDKRIGQEVDGEAVGDEFKGYVF
KISGGNDKQGFPAIVGPDLAVLALVIVKKGEQELEGLTDTTVPKRLGPKR
ANNIRKFFGLSKEDDVRDFVIRREVTKGEKTYTKAPKIQRLVTPQRLQRK
RHQRALKVRNAQAQREAAAEYAQLLAKRLSER

3D structure

• PDB: 6lqs Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
• Chain: SH
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SH	K2 N4 Q13 S53 N56 Q59 V108 K131 R132 L133 G134 K136 R137 N139 N140 R154 R159 R160 Y169 K171 A172 P173 K174 I175 Q176 R177 L178 V179 Q182 R183 L184 Q185 R186 R188 Q190 K194 V195 N197 Q199 Q201 R202	K2 N4 Q13 S53 N56 Q59 V71 K94 R95 L96 G97 K99 R100 N102 N103 R117 R122 R123 Y132 K134 A135 P136 K137 I138 Q139 R140 L141 V142 Q145 R146 L147 Q148 R149 R151 Q153 K157 V158 N160 Q162 Q164 R165

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006364 rRNA processing
• GO:0006412 translation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0030686 90S preribosome
• GO:0032040 small-subunit processome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6lqs, PDBe:6lqs, PDBj:6lqs
• PDBsum: 6lqs
• PubMed: 32943522
• UniProt: P0CX37|RS6A_YEAST Small ribosomal subunit protein eS6A (Gene Name=RPS6A)