Structure of PDB 6ke6 Chain SH

Receptor sequence
>6ke6SH (length=112) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
MKLNISYPVNGSQKTFEIDDEHRIRVFFDKRIGQEVDGEAVGDEFKGYVF
KISGGNDKQGFPMKQGVLLPTRIKLLLTRKRKSVRGAIVGPDLAVLALVI
VKKGEQELEGLT
3D structure
PDB6ke6 3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
ChainSH
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SH N4 P8 Q13 T15 S53 N56 D57 Q59 G60 F61 P62 R72 R92 K93 R94 A107 V108 N4 P8 Q13 T15 S53 N56 D57 Q59 G60 F61 P62 R72 R79 K80 R81 A94 V95
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0006412 translation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0030686 90S preribosome
GO:0032040 small-subunit processome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ke6, PDBe:6ke6, PDBj:6ke6
PDBsum6ke6
PubMed
UniProtP0CX37|RS6A_YEAST Small ribosomal subunit protein eS6A (Gene Name=RPS6A)

[Back to BioLiP]