Structure of PDB 8ovj Chain SG

Receptor sequence

>8ovjSG (length=233) Species: 347515 (Leishmania major strain Friedlin)

MKLNIAYPRNGTVKQFEISDEVLRRVQLQDYRLGNEVDGAIFGSEFKGYI
FRLRGGSDKDGFPMVPGVLASSRVSLLVKRGAIGFNTFRGYQGERRRKNV
RGCVLASDIALVNVTISKVGDQPIEGVTDTTAPRRLGPKRASKIRKLFNL
SRTEDVRKYVVRRRVVKSGKKDRLKAPKIQRLITPRVKARRAKKAKDAIA
KVRASAAERREYLRLIASNRRALRQRDHSKKHT

3D structure

• PDB: 8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
• Chain: SG
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SG	K2 N4 Q15 R32 R52 K59 D60 G61 P63 V68 N86 R89 Q92 G93 R95 R96 R97 K98 N99 N113 R134 R135 L136 K139 R140 S142 R145 R152 R162 R163 K171 R173 K175 P177 Q180 R181 R186 K188 R190 R191 K194 I199 K201 V202 R203 S205 A217 R220 R221 R224 Q225 R226 S229	K2 N4 Q15 R32 R52 K59 D60 G61 P63 V68 N86 R89 Q92 G93 R95 R96 R97 K98 N99 N113 R134 R135 L136 K139 R140 S142 R145 R152 R162 R163 K171 R173 K175 P177 Q180 R181 R186 K188 R190 R191 K194 I199 K201 V202 R203 S205 A217 R220 R221 R224 Q225 R226 S229

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8ovj, PDBe:8ovj, PDBj:8ovj
• PDBsum: 8ovj
• PubMed: 38722744
• UniProt: Q9NE83|RS6_LEIMA Small ribosomal subunit protein eS6 (Gene Name=RPS6)