Structure of PDB 6ke6 Chain SG

Receptor sequence
>6ke6SG (length=213) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
DFEVVEEFTPVVLATPIPEEVQQAQTEIKLFNKWSFEEVEVKDASLVDYV
QVRQPIFVAHTAGRYANKRFRKAQCPIIERLTNSLMMNGRNNGKKLKAVR
IIKHTLDIINVLTDQNPIQVVVDAITNTGPREDTTRVGGGGAARRQAVDV
SPLRRVNQAIALLTIGAREAAFRNIKTIAETLAEELINAAKGSSTSYAIK
KKDELERVAKSNR
3D structure
PDB6ke6 3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
ChainSG
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SG H72 A78 K80 R81 K84 R92 N95 M98 M99 N100 R102 N103 N104 G105 K107 K109 R112 N169 I187 H60 A66 K68 R69 K72 R80 N83 M86 M87 N88 R90 N91 N92 G93 K95 K97 R100 N157 I175
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0000054 ribosomal subunit export from nucleus
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006450 regulation of translational fidelity
GO:0030490 maturation of SSU-rRNA
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:0030686 90S preribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ke6, PDBe:6ke6, PDBj:6ke6
PDBsum6ke6
PubMed
UniProtP26783|RS5_YEAST Small ribosomal subunit protein uS7 (Gene Name=RPS5)

[Back to BioLiP]