Structure of PDB 3j9z Chain SG

Receptor sequence

>3j9zSG (length=178) Species: 562 (Escherichia coli) [Search protein sequence]

PRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLA
QRSGKSELEAFEVALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAM
RWIVEAARKRGDKSMALRLANELSDAAENKGTAVKKREDVHRMAEANKAF
AHYRWLSLRSFSHQAGASSKQPALGYLN

3D structure

PDB

3j9z Activation of GTP hydrolysis in mRNA-tRNA translocation by elongation factor G.

Chain

Resolution

3.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SG	P1 R2 R3 R4 R9 K24 N27 M30 D32 K34 K35 T37 K75 R77 R78 G81 R91 R94 R101 R108 K113 S114 M115 R159 S160 H163 G175	P1 R2 R3 R4 R9 K24 N27 M30 D32 K34 K35 T37 K75 R77 R78 G81 R91 R94 R101 R108 K113 S114 M115 R159 S160 H163 G175
BS02	rna	SG	S82 Y84 Q85 R142	S82 Y84 Q85 R142

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0017148	negative regulation of translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0016020	membrane
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3j9z, PDBe:3j9z, PDBj:3j9z
PDBsum	3j9z
PubMed	26229983
UniProt	P02359\|RS7_ECOLI Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]