Structure of PDB 8yop Chain SF

Receptor sequence

>8yopSF (length=184) Species: 9606 (Homo sapiens)

DIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAAKRFRKAQ
CPIVERLTNSMMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNA
IINSGPREDSTRIGRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIA
ECLADELINAAKGSSNSYAIKKKDELERVAKSNR

3D structure

• PDB: 8yop Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
• Chain: SF
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SF	H51 A57 R60 K63 R71 N74 M76 M78 H79 G80 R81 N82 N83 G84 K85 K86 M88 R145 N148 W152 R159 F163 R164 I166 I169	H36 A42 R45 K48 R56 N59 M61 M63 H64 G65 R66 N67 N68 G69 K70 K71 M73 R125 N128 W132 R139 F143 R144 I146 I149

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006413 translational initiation
• GO:0006450 regulation of translational fidelity
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0005925 focal adhesion
• GO:0016020 membrane
• GO:0022626 cytosolic ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0032040 small-subunit processome
• GO:0045202 synapse
• GO:0070062 extracellular exosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8yop, PDBe:8yop, PDBj:8yop
• PDBsum: 8yop
• PubMed: 38942792
• UniProt: P46782|RS5_HUMAN Small ribosomal subunit protein uS7 (Gene Name=RPS5)