Structure of PDB 8rxx Chain SF

Receptor sequence

>8rxxSF (length=218) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

EWVPCTKLGRLVKAQKVTSLEEIFLFSMPIKEHQIVDTLIAEGQLHDEMM
KIYPVQKATSAGQRTRFKAFNVVGDCDGHIGIGARVGKEVSLAIRASMIA
AKLNIVPVRRGYWGNKIGEPHTIPMKVTGKCGSVAVRLVPAPRGTGIVAA
PVPKKILEFAGVEDVYTSSRGKTRTHGNLIMATFYALRKTYGFLTPDLWA
DTEPSRDPTDEHAELLAE

3D structure

PDB

8rxx Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.97 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SF	V98 Q99 K100 A101 T102 A104 R109 K111 T171 K173 C174 G175 S176 R180 I190 V191 A192 A193 K197 Y209 T210 S212 R213 K215 T216 R217 T218 H219 N221 F236	V55 Q56 K57 A58 T59 A61 R66 K68 T128 K130 C131 G132 S133 R137 I147 V148 A149 A150 K154 Y166 T167 S169 R170 K172 T173 R174 T175 H176 N178 F193

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8rxx, PDBe:8rxx, PDBj:8rxx
PDBsum	8rxx
PubMed	38722744
UniProt	Q4QDL5

[Back to BioLiP]