Structure of PDB 7mq8 Chain SF

Receptor sequence
>7mq8SF (length=123) Species: 9606 (Homo sapiens) [Search protein sequence]
VNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIV
MAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVT
IKEGSQLKQQIQSIQQSIERLLV
3D structure
PDB7mq8 Nucleolar maturation of the human small subunit processome.
ChainSF
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna SF G38 A39 N40 E41 K44 R48 I65 V95 S96 R97 I100 G33 A34 N35 E36 K39 R43 I60 V90 S91 R92 I95
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030515 snoRNA binding
GO:0030621 U4 snRNA binding
GO:0030622 U4atac snRNA binding
GO:0034511 U3 snoRNA binding
GO:0034512 box C/D sno(s)RNA binding
GO:0051117 ATPase binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0000492 box C/D snoRNP assembly
GO:0006397 mRNA processing
GO:0007338 single fertilization
GO:0008380 RNA splicing
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0001651 dense fibrillar component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005690 U4atac snRNP
GO:0005730 nucleolus
GO:0031428 box C/D methylation guide snoRNP complex
GO:0032040 small-subunit processome
GO:0032991 protein-containing complex
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome
GO:0071011 precatalytic spliceosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7mq8, PDBe:7mq8, PDBj:7mq8
PDBsum7mq8
PubMed34516797
UniProtP55769|NH2L1_HUMAN NHP2-like protein 1 (Gene Name=SNU13)

[Back to BioLiP]