Structure of PDB 6t7i Chain SF

Receptor sequence

>6t7iSF (length=206) Species: 4932 (Saccharomyces cerevisiae)

FTPVVLATPIPEEVQQAQTEIKLFNKWSFEEVEVKDASLVDYVQVRQPIF
VAHTAGRYANKRFRKAQCPIIERLTNSLMMNGRNNGKKLKAVRIIKHTLD
IINVLTDQNPIQVVVDAITNTGPREDTTRVGGGGAARRQAVDVSPLRRVN
QAIALLTIGAREAAFRNIKTIAETLAEELINAAKGSSTSYAIKKKDELER
VAKSNR

3D structure

• PDB: 6t7i Molecular mechanism of translational stalling by inhibitory codon combinations and poly(A) tracts.
• Chain: SF
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SF	H72 A78 K80 R81 K84 R92 N95 L97 N100 G101 R102 N103 N104 K106 K107 K109 R112 R166 N169 R180 F184 R185 N186 I187 T189 I190	H53 A59 K61 R62 K65 R73 N76 L78 N81 G82 R83 N84 N85 K87 K88 K90 R93 R147 N150 R161 F165 R166 N167 I168 T170 I171
BS02	rna	SF	G153 A154	G134 A135
BS03	rna	SF	R148 E216	R129 E197

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6t7i, PDBe:6t7i, PDBj:6t7i
• PDBsum: 6t7i
• PubMed: 31858614
• UniProt: A0A1L4AA68