Structure of PDB 8rxx Chain SE

Receptor sequence

>8rxxSE (length=260) Species: 347515 (Leishmania major strain Friedlin)

AKKHLKRLYAPKDWMLSKLTGVFAPRPRPGPHKLRECLPLLVIIRNRLKY
ALNAREGEMILRQGLVHVDNHPRRDGKYPAGFMDVVEIPKTGDRFRLMYD
VKGRFALVNLSEAEAQIKLMKVVNLYTATGRVPVAVTHDGHRIRYPDPHT
SIGDTIVYNVKEKKCVDLIKNRQGKAVIVTGGANRGRIGEIVKVECHPGA
FNIAHLKDASGAEFATRAANIFVIGKDLNNLQVTVPKQQGLRMNVIQERE
ERLIAAEARK

3D structure

• PDB: 8rxx Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
• Chain: SE
• Resolution: 2.97 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SE	A2 K3 K4 H5 K7 R8 L9 Y10 K13 M16 S18 K19 G22 V23 F24 A25 P26 R27 P30 G31 K34 L35 R46 N54 A55 E59 M60 R63 Q64 R74 K78 K103 R105 N125 Y127 T128 A129 T130 G131 R132 G141 H142 R143 R145 I153 L169 K171 R173 G183 A184 N185 E196 H198 P199 G200 A216 R218 K238 V246 R250	A1 K2 K3 H4 K6 R7 L8 Y9 K12 M15 S17 K18 G21 V22 F23 A24 P25 R26 P29 G30 K33 L34 R45 N53 A54 E58 M59 R62 Q63 R73 K77 K102 R104 N124 Y126 T127 A128 T129 G130 R131 G140 H141 R142 R144 I152 L168 K170 R172 G182 A183 N184 E195 H197 P198 G199 A215 R217 K237 V245 R249

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8rxx, PDBe:8rxx, PDBj:8rxx
• PDBsum: 8rxx
• PubMed: 38722744
• UniProt: Q4QG31