Structure of PDB 8ovj Chain SE

Receptor sequence

>8ovjSE (length=260) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

AKKHLKRLYAPKDWMLSKLTGVFAPRPRPGPHKLRECLPLLVIIRNRLKY
ALNAREGEMILRQGLVHVDNHPRRDGKYPAGFMDVVEIPKTGDRFRLMYD
VKGRFALVNLSEAEAQIKLMKVVNLYTATGRVPVAVTHDGHRIRYPDPHT
SIGDTIVYNVKEKKCVDLIKNRQGKAVIVTGGANRGRIGEIVKVECHPGA
FNIAHLKDASGAEFATRAANIFVIGKDLNNLQVTVPKQQGLRMNVIQERE
ERLIAAEARK

3D structure

PDB

8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SE	K4 H5 K7 L9 Y10 S18 K19 F24 P26 R27 P30 G31 K34 R46 A55 E59 M60 R63 Q64 R74 K78 K103 R105 Y127 T128 A129 T130 G131 R132 R143 R145 L169 K171 R173 G200 A216 R218 R250 R260	K3 H4 K6 L8 Y9 S17 K18 F23 P25 R26 P29 G30 K33 R45 A54 E58 M59 R62 Q63 R73 K77 K102 R104 Y126 T127 A128 T129 G130 R131 R142 R144 L168 K170 R172 G199 A215 R217 R249 R259

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ovj, PDBe:8ovj, PDBj:8ovj
PDBsum	8ovj
PubMed	38722744
UniProt	Q4QG31

[Back to BioLiP]