Structure of PDB 8fl3 Chain SE

Receptor sequence

>8fl3SE (length=233) Species: 9606 (Homo sapiens)

KVVNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLK
VPPAINQFTQALDRQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAARP
PVLRAGVNTVTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCI
IKGKARLGRLVHRKTCTTVAFTQVNSEDKGALAKLVEAIRTNYNDRYDEI
RRHWGGNVLGPKSVARIAKLEKAKAKELATKLG

3D structure

• PDB: 8fl3 Principles of human pre-60 S biogenesis.
• Chain: SE
• Resolution: 2.53 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SE	Y60 I61 Q64 R65 R89 D160 K185 R189	Y35 I36 Q39 R40 R64 D127 K152 R156
BS02	rna	SE	E33 R35 K37 I41 Q43 I45 Q46 K48 L51 R53 F54 K56 P58 R59 Y60 A68 I69 K72 R73 L74 E105 K107 Q108 K110 K111 R132 G139 N141 T142 D162 L166 K187 A188 R196 K197 T198 C199 T200 G243 P244 K245 S246 R249	E8 R10 K12 I16 Q18 I20 Q21 K23 L26 R28 F29 K31 P33 R34 Y35 A43 I44 K47 R48 L49 E80 K82 Q83 K85 K86 R99 G106 N108 T109 D129 L133 K154 A155 R163 K164 T165 C166 T167 G210 P211 K212 S213 R216

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0045296 cadherin binding

Biological Process

• GO:0000470 maturation of LSU-rRNA
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0005925 focal adhesion
• GO:0016020 membrane
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:0045202 synapse
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8fl3, PDBe:8fl3, PDBj:8fl3
• PDBsum: 8fl3
• PubMed: 37410842
• UniProt: P62424|RL7A_HUMAN Large ribosomal subunit protein eL8 (Gene Name=RPL7A)