Structure of PDB 8fkw Chain SE

Receptor sequence

>8fkwSE (length=185) Species: 9606 (Homo sapiens)

KWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPE
TKQEKKQRLLARAEKKAAGKGDVPTKRPPVLRAGVNTVTTLVENKKAQLV
VIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGRLVHRKTCTTVAFT
QVNSEDKGALAKLVEAIRTNYNDRYDEIRRHWGGN

3D structure

• PDB: 8fkw Principles of human pre-60 S biogenesis.
• Chain: SE
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SE	Y60 I61 Q64 R65 R89 H159 D160 K185 R189	Y5 I6 Q9 R10 R34 H104 D105 K130 R134
BS02	rna	SE	K97 K217	K42 K162
BS03	rna	SE	P58 R59 Y60 K110 K111 Q112 R132 P133 V135 R137 G139 N141 T142 T145 D162 L166 A188 R196 K197 T198 C199 T200	P3 R4 Y5 K55 K56 Q57 R77 P78 V80 R82 G84 N86 T87 T90 D107 L111 A133 R141 K142 T143 C144 T145

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0045296 cadherin binding

Biological Process

• GO:0000470 maturation of LSU-rRNA
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0005925 focal adhesion
• GO:0016020 membrane
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:0045202 synapse
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8fkw, PDBe:8fkw, PDBj:8fkw
• PDBsum: 8fkw
• PubMed: 37410842
• UniProt: P62424|RL7A_HUMAN Large ribosomal subunit protein eL8 (Gene Name=RPL7A)