Structure of PDB 8fkp Chain SE

Receptor sequence

>8fkpSE (length=186) Species: 9606 (Homo sapiens) [Search protein sequence]

KWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPE
TKQEKKQRLLARAEKKAAGKGDVPTKRPPVLRAGVNTVTTLVENKKAQLV
VIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGRLVHRKTCTTVAFT
QVNSEDKGALAKLVEAIRTNYNDRYDEIRRHWGGNV

3D structure

PDB

8fkp Principles of human pre-60S biogenesis

Chain

Resolution

2.85 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SE	W57 Y60 Q64 R65 R89 H159 D160 K185 R189	W2 Y5 Q9 R10 R34 H104 D105 K130 R134
BS02	rna	SE	Y60 K110 K111 Q112 R132 P133 V135 R137 G139 N141 T142 D162 L166 A188 R196 K197 T198 C199 T200	Y5 K55 K56 Q57 R77 P78 V80 R82 G84 N86 T87 D107 L111 A133 R141 K142 T143 C144 T145

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0045296	cadherin binding

	Biological Process
GO:0000470	maturation of LSU-rRNA
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0005925	focal adhesion
GO:0016020	membrane
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:0045202	synapse
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8fkp, PDBe:8fkp, PDBj:8fkp
PDBsum	8fkp
PubMed	37410842
UniProt	P62424\|RL7A_HUMAN Large ribosomal subunit protein eL8 (Gene Name=RPL7A)

[Back to BioLiP]