Structure of PDB 7n30 Chain SE

Receptor sequence

>7n30SE (length=155) Species: 83333 (Escherichia coli K-12) [Search protein sequence]

LQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAI
QKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIAGGA
MRAVLEVAGVHNVLAKAYGSTNPINVVRATIDGLENMNSPEMVAAKRGKS
VEEIL

3D structure

PDB

7n30 Structural basis of early translocation events on the ribosome.

Chain

Resolution

2.66 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SE	V21 S22 K23 T24 V25 K26 G27 R29 Y50 K52 R54 K62 R69 H89 T90 F95 Q97 A99 S100 T103 A107 G108 R112 L124 A125 K126 A127 Y128 S130 T131 N132 N135 R138	V11 S12 K13 T14 V15 K16 G17 R19 Y40 K42 R44 K52 R59 H79 T80 F85 Q87 A89 S90 T93 A97 G98 R102 L114 A115 K116 A117 Y118 S120 T121 N122 N125 R128

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0046677	response to antibiotic
GO:1990145	maintenance of translational fidelity

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7n30, PDBe:7n30, PDBj:7n30
PDBsum	7n30
PubMed	34234344
UniProt	P0A7W1\|RS5_ECOLI Small ribosomal subunit protein uS5 (Gene Name=rpsE)

[Back to BioLiP]