Structure of PDB 6zu5 Chain SDD

Receptor sequence

>6zu5SDD (length=59) Species: 235221 (Paranosema locustae)

NIKIKPGSYAGRVDTRKFGRGSRSCRACFTHRGIIRQYNLYLCRRCFREY
ALEIGFKKV

3D structure

• PDB: 6zu5 Differences in structure and hibernation mechanism highlight diversification of the microsporidian ribosome.
• Chain: SDD
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SDD	K8 R15 R19 F21 G22 R23 R26 C31 T33 H34 R35 G36 I37 I38 R39 Q40 R47 R48 C49 R51 E52 V62	K5 R12 R16 F18 G19 R20 R23 C28 T30 H31 R32 G33 I34 I35 R36 Q37 R44 R45 C46 R48 E49 V59
BS02	ZN	SDD	C28 C31 C46 C49	C25 C28 C43 C46

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Dec 1 18:54:08 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6zu5', asym_id = 'SDD', title = 'Differences in structure and hibernation mechani...t diversification of the microsporidian ribosome.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6zu5', asym_id='SDD', title='Differences in structure and hibernation mechani...t diversification of the microsporidian ribosome.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412,0008270', uniprot = '', pdbid = '6zu5', asym_id = 'SDD'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0008270', uniprot='', pdbid='6zu5', asym_id='SDD')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>