Structure of PDB 6rm3 Chain SCC

Receptor sequence

>6rm3SCC (length=63) Species: 6039 (Vairimorpha necatrix)

EANLQQQFYCKVLKTADRAGSAGALVLVRVELLNNGRKMNRLIKGSVREG
DIIALLECEREHR

3D structure

• PDB: 6rm3 Evolutionary compaction and adaptation visualized by the structure of the dormant microsporidian ribosome.
• Chain: SCC
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SCC	R19 S22 A23 S47	R18 S21 A22 S46

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 22:28:54 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6rm3', asym_id = 'SCC', title = 'Evolutionary compaction and adaptation visualize...structure of the dormant microsporidian ribosome.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6rm3', asym_id='SCC', title='Evolutionary compaction and adaptation visualize...structure of the dormant microsporidian ribosome.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '6rm3', asym_id = 'SCC'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='6rm3', asym_id='SCC')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>