Structure of PDB 6lqq Chain SC

Receptor sequence

>6lqqSC (length=230) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

GQKKRVVDPFTRKEWFDIKAPSTFENRNVGKTLVNKSTGLKSASDALKGR
VVEVCLADLQGSEDHSFRKIKLRVDEVQGKNLLTNFHGMDFTTDKLRSMV
RKWQTLIEANVTVKTSDDYVLRIFAIAFTRKQANQVKRHSYAQSSHIRAI
RKVISEILTKEVQGSTLAQLTSKLIPEVINKEIENATKDIFPLQNIHVRK
VKLLKQPKFDVGALMALHGEGSGEEKGKKV

3D structure

PDB

6lqq Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.

Chain

Resolution

4.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SC	K17 P23 K27 V114 K116 W117 Q118 L120 N124 R136 F138 Q146 N148 Q149 V150 K151 H153 Y155 Q157 S158 S159 R165 K202 D203 I204 F205 P206 K216	K3 P9 K13 V100 K102 W103 Q104 L106 N110 R122 F124 Q132 N134 Q135 V136 K137 H139 Y141 Q143 S144 S145 R151 K188 D189 I190 F191 P192 K202

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0030686	90S preribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6lqq, PDBe:6lqq, PDBj:6lqq
PDBsum	6lqq
PubMed	32943522
UniProt	P33442\|RS3A1_YEAST Small ribosomal subunit protein eS1A (Gene Name=RPS1A)

[Back to BioLiP]