Structure of PDB 3j9z Chain SC

Receptor sequence

>3j9zSC (length=232) Species: 562 (Escherichia coli) [Search protein sequence]

GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKAS
VSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQI
NIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKV
EVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVW
IFKGEILGGMAAVEQPEKPAAQPKKQQRKGRK

3D structure

PDB

3j9z Activation of GTP hydrolysis in mRNA-tRNA translocation by elongation factor G.

Chain

Resolution

3.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SC	G1 Q2 K3 V4 K26 R126 G154 R155 E160 W166 R168 R171 V172 P173 L174 H175 T176 L177 R178 V194 K198 K218 Q226 Q227 K229 G230 R231 K232	G1 Q2 K3 V4 K26 R126 G154 R155 E160 W166 R168 R171 V172 P173 L174 H175 T176 L177 R178 V194 K198 K218 Q226 Q227 K229 G230 R231 K232

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3j9z, PDBe:3j9z, PDBj:3j9z
PDBsum	3j9z
PubMed	26229983
UniProt	P0A7V3\|RS3_ECOLI Small ribosomal subunit protein uS3 (Gene Name=rpsC)

[Back to BioLiP]