Structure of PDB 7qca Chain SBB

Receptor sequence
>7qcaSBB (length=81) Species: 1358809 (Spraguea lophii 42_110) [Search protein sequence]
IAKNLLYPTVEEIKKNNKRKQLFQEVKGYFMEVKCAGCATLNVCYSHSQK
TISCKGCSMVILRSTGGKAKISNECSYMVIS
3D structure
PDB7qca Spraguea lophii ribosome
ChainSBB
Resolution2.79 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SBB K15 K16 N18 K19 K21 V27 K28 Y46 Q50 G67 K69 K14 K15 N17 K18 K20 V26 K27 Y45 Q49 G66 K68
BS02 ZN SBB C36 C55 C58 C35 C54 C57
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Tue Dec 3 04:41:59 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7qca', asym_id = 'SBB', title = 'Spraguea lophii ribosome'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7qca', asym_id='SBB', title='Spraguea lophii ribosome')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '7qca', asym_id = 'SBB'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='7qca', asym_id='SBB')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>