Structure of PDB 6zu5 Chain SBB

Receptor sequence
>6zu5SBB (length=80) Species: 235221 (Paranosema locustae) [Search protein sequence]
KDLAFPTAEELRTTCKRKRLIPQNNSYFLYLRCKSCDIIILAYSHSQTRR
TCPGCNMVMLMPKGGKARIEGDVKIKKIKR
3D structure
PDB6zu5 Differences in structure and hibernation mechanism highlight diversification of the microsporidian ribosome.
ChainSBB
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SBB E12 R15 T16 C18 K19 K21 N27 S29 F31 Y46 H48 Q50 P65 K66 G67 G68 K69 E9 R12 T13 C15 K16 K18 N24 S26 F28 Y43 H45 Q47 P62 K63 G64 G65 K66
BS02 ZN SBB C36 C39 C55 C33 C36 C52
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Dec 1 15:09:27 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6zu5', asym_id = 'SBB', title = 'Differences in structure and hibernation mechani...t diversification of the microsporidian ribosome.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6zu5', asym_id='SBB', title='Differences in structure and hibernation mechani...t diversification of the microsporidian ribosome.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '6zu5', asym_id = 'SBB'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='6zu5', asym_id='SBB')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>