Structure of PDB 8gym Chain SB

Receptor sequence

>8gymSB (length=279) Species: 312017 (Tetrahymena thermophila SB210)

SICLESISGTIKGLQKANYVVEHNPNLTSEEKKHLKQFLVYRYNPADPHD
QPKYVSYWCDIKKFPPMFLDAILYIKNELDPTLSIRRSCREGICGSCAVN
CDGLHTLACISGFNRDLSKPTIITPLGHMFILKDLVVDMTNFYAQYKMIE
PYLKRKTPKPDANKEYPQSPEQRALLDGLYECVLCAACSTSCPSYWWHPD
RYLGPAILQQAYRWIVDSRDEYTQERIERIAEDVRLDDCQQIGMCSFTCP
KGLNPQLSLKNLMDMVKDFRQKRIEQEVL

3D structure

• PDB: 8gym Structures of Tetrahymena thermophila respiratory megacomplexes on the tubular mitochondrial cristae.
• Chain: SB
• Resolution: 2.96 Å

Enzymatic activity

• Enzyme Commision number: 1.3.5.1: succinate dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FES	SB	C122 R123 C127 G128 C130 L140 C142	C89 R90 C94 G95 C97 L107 C109
BS02	SF4	SB	C215 V216 C218 A219 A220 C221 A239 C282	C182 V183 C185 A186 A187 C188 A206 C249
BS03	F3S	SB	C225 C272 Q273 Q274 I275 G276 M277 C278 Q289	C192 C239 Q240 Q241 I242 G243 M244 C245 Q256
BS04	U10	SB	P226 W230 Q273 I275	P193 W197 Q240 I242

Gene Ontology

Molecular Function

• GO:0008177 succinate dehydrogenase (quinone) activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding
• GO:0051538 3 iron, 4 sulfur cluster binding

Biological Process

• GO:0006099 tricarboxylic acid cycle
• GO:0009060 aerobic respiration
• GO:0022904 respiratory electron transport chain

Cellular Component

• GO:0005743 mitochondrial inner membrane

External links

• PDB: RCSB:8gym, PDBe:8gym, PDBj:8gym
• PDBsum: 8gym
• PubMed: 37248254
• UniProt: I7M403