Structure of PDB 8fl3 Chain SB

Receptor sequence

>8fl3SB (length=254) Species: 9606 (Homo sapiens) [Search protein sequence]

GFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRM
IVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCT
GLLLARRLLNRFGMDKIYEGQVEVTGDEYNVESIDGQPGAFTCYLDAGLA
RTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHIMG
QNVADYMRYLMEEDEDAYKKQFSQYIKNSVTPDMMEEMYKKAHAAIRENP
VYEK

3D structure

PDB

8fl3 Principles of human pre-60 S biogenesis.

Chain

Resolution

2.53 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SB	K5 K8 Y12 Y16 Q17 K19 R23 G26 T28 D29 R35 L36 K43 Y44 K48 Y49 F113 M115 G140 Y145 L150 R152 P174 H175 S176 R179	K4 K7 Y11 Y15 Q16 K18 R22 G25 T27 D28 R34 L35 K42 Y43 K47 Y48 F112 M114 G139 Y144 L149 R151 P173 H174 S175 R178
BS02	rna	SB	F13 K14 F20 R21 R22 R24 T28 Y30 R33 I52 R54 T56 N57 R58 I61 Q63 I69 E70 D72 M73 I74 N94 R152 T155 G156 N157 K158 V204 Y207 K221 Q222 S224 Q225 Y226 Y253 K255	F12 K13 F19 R20 R21 R23 T27 Y29 R32 I51 R53 T55 N56 R57 I60 Q62 I68 E69 D71 M72 I73 N93 R151 T154 G155 N156 K157 V203 Y206 K220 Q221 S223 Q224 Y225 Y252 K254

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003730	mRNA 3'-UTR binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding
GO:0031625	ubiquitin protein ligase binding
GO:0048027	mRNA 5'-UTR binding
GO:1990948	ubiquitin ligase inhibitor activity

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006364	rRNA processing
GO:0006412	translation
GO:0010628	positive regulation of gene expression
GO:0042273	ribosomal large subunit biogenesis
GO:0045727	positive regulation of translation
GO:0050821	protein stabilization
GO:1901796	regulation of signal transduction by p53 class mediator
GO:1904667	negative regulation of ubiquitin protein ligase activity
GO:2000059	negative regulation of ubiquitin-dependent protein catabolic process
GO:2000435	negative regulation of protein neddylation

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005829	cytosol
GO:0005840	ribosome
GO:0005925	focal adhesion
GO:0016020	membrane
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:0032991	protein-containing complex
GO:0070062	extracellular exosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8fl3, PDBe:8fl3, PDBj:8fl3
PDBsum	8fl3
PubMed	37410842
UniProt	P46777\|RL5_HUMAN Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]