Structure of PDB 8fl0 Chain SB

Receptor sequence

>8fl0SB (length=230) Species: 9606 (Homo sapiens) [Search protein sequence]

KRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIICQ
IAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRF
GMDKIYEDEYNVESGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPH
STKRFPGYDSESKEFNAEVHRKHIMGQNVADYMRYLMEEDEDAYKKQFSQ
YIKNSVTPDMMEEMYKKAHAAIRENPVYEK

3D structure

PDB

8fl0 Principles of human pre-60 S biogenesis.

Chain

Resolution

2.91 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SB	Y16 Q17 K19 R23 T28 R35 D40 K48 Y145 L150 R152 T153 P174 H175 S176 R179	Y3 Q4 K6 R10 T15 R22 D27 K35 Y120 L125 R127 T128 P149 H150 S151 R154
BS02	rna	SB	K14 Y16 V18 F20 R21 R22 R24 T28 Y30 R33 I52 R54 T56 N57 E70 D72 M73 I74 N94 Y95 R152 T154 T155 N157 K158 V204 Y207 K221 Q222 F223 S224 Q225 Y226 Y253 K255	K1 Y3 V5 F7 R8 R9 R11 T15 Y17 R20 I39 R41 T43 N44 E57 D59 M60 I61 N81 Y82 R127 T129 T130 N132 K133 V179 Y182 K196 Q197 F198 S199 Q200 Y201 Y228 K230

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003730	mRNA 3'-UTR binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding
GO:0031625	ubiquitin protein ligase binding
GO:0048027	mRNA 5'-UTR binding
GO:1990948	ubiquitin ligase inhibitor activity

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006364	rRNA processing
GO:0006412	translation
GO:0010628	positive regulation of gene expression
GO:0042273	ribosomal large subunit biogenesis
GO:0045727	positive regulation of translation
GO:0050821	protein stabilization
GO:1901796	regulation of signal transduction by p53 class mediator
GO:1904667	negative regulation of ubiquitin protein ligase activity
GO:2000059	negative regulation of ubiquitin-dependent protein catabolic process
GO:2000435	negative regulation of protein neddylation

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005829	cytosol
GO:0005840	ribosome
GO:0005925	focal adhesion
GO:0016020	membrane
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:0032991	protein-containing complex
GO:0070062	extracellular exosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8fl0, PDBe:8fl0, PDBj:8fl0
PDBsum	8fl0
PubMed	37410842
UniProt	P46777\|RL5_HUMAN Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]