Structure of PDB 8btd Chain SB

Receptor sequence

>8btdSB (length=216) Species: 184922 (Giardia lamblia ATCC 50803) [Search protein sequence]

EEWHPSTKLGRLVKAGKIESLYDIFKYSLPIKETEIIDYFFPKSELAEEV
CNIMSVQKQTTAGQRTRFRAHVIVGNRDGFIGYGAGVSKEVANAIKKAAK
NARLNIVPVRRGFWGGKLGDPHTVSSKLSGKCGSVRVRLIPAPRGAGIVA
SPTVAKVLEFAGVSDVFTRQSGHSRTLMNSVGAVYNALKSSYSILTPDLW
KKEQLDHVQDIRTMSL

3D structure

PDB

8btd Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.

Chain

Resolution

4.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SB	V80 Q81 K82 Q83 T84 T85 A86 R89 R93 K124 K151 S153 K155 S158 R160 R162 V173 A174 S175 P176 F191 T192 R193 Q194 S195 H197 S198 R199 N203	V56 Q57 K58 Q59 T60 T61 A62 R65 R69 K100 K127 S129 K131 S134 R136 R138 V149 A150 S151 P152 F167 T168 R169 Q170 S171 H173 S174 R175 N179

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8btd, PDBe:8btd, PDBj:8btd
PDBsum	8btd
PubMed	36912103
UniProt	A8BMZ1

[Back to BioLiP]