Structure of PDB 7wtm Chain SB

Receptor sequence
>7wtmSB (length=216) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
VVDPFTRKEWFDIKAPSTFENRNVGKTLVNKSTGLKSASDALKGRVVEVC
LADLQGSEDHSFRKIKLRVDEVQGKNLLTNFHGMDFTTDKLRSMVRKWQT
LIEANVTVKTSDDYVLRIFAIAFTRKQANQVKRHSYAQSSHIRAIRKVIS
EILTKEVQGSTLAQLTSKLIPEVINKEIENATKDIFPLQNIHVRKVKLLK
QPKFDVGALMALHGEG
3D structure
PDB7wtm In vitro structural maturation of an early stage pre-40S particle coupled with U3 snoRNA release and central pseudoknot formation.
ChainSB
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SB K27 V114 R115 K116 W117 Q118 L120 N124 R136 F138 Q146 N148 Q149 V150 K151 H153 Y155 Q157 S158 S159 H160 R165 K202 I204 K216 K8 V95 R96 K97 W98 Q99 L101 N105 R117 F119 Q127 N129 Q130 V131 K132 H134 Y136 Q138 S139 S140 H141 R146 K183 I185 K197
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0030686 90S preribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7wtm, PDBe:7wtm, PDBj:7wtm
PDBsum7wtm
PubMed36263816
UniProtP33442|RS3A1_YEAST Small ribosomal subunit protein eS1A (Gene Name=RPS1A)

[Back to BioLiP]