Structure of PDB 6om0 Chain SB

Receptor sequence

>6om0SB (length=214) Species: 9606 (Homo sapiens) [Search protein sequence]

VVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVS
LADLQNDEVAFRKFKLITEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTM
IEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYAQHQQVRQIRKKMME
IMTREVQTNDLKEVVNKLIPDSIGKDIEKACQSIYPLHDVFVRKVKMLKK
PKFELGKLMELHGE

3D structure

PDB

6om0 Structural basis for selective stalling of human ribosome nascent chain complexes by a drug-like molecule.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SB	P24 F25 K28 H101 V114 K115 K116 W117 M120 H124 R136 F138 R146 N148 Q149 I150 R151 Y155 Q157 H158 Q159 Q160 R162 R165 Q202 S203 I204 Y205 P206 K214 K216	P4 F5 K8 H81 V94 K95 K96 W97 M100 H104 R116 F118 R126 N128 Q129 I130 R131 Y135 Q137 H138 Q139 Q140 R142 R145 Q182 S183 I184 Y185 P186 K194 K196
BS02	rna	SB	E224 K227 M229	E204 K207 M209

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6om0, PDBe:6om0, PDBj:6om0
PDBsum	6om0
PubMed	31160784
UniProt	P61247\|RS3A_HUMAN Small ribosomal subunit protein eS1 (Gene Name=RPS3A)

[Back to BioLiP]