Structure of PDB 6zu5 Chain SAA

Receptor sequence
>6zu5SAA (length=97) Species: 235221 (Paranosema locustae) [Search protein sequence]
PVKRKNHGRAKKNRGHVKLIRCDNCASAVPKDKAIKRFQIKSLIEAAAHD
DVRTATIYEEYEVPKFFHKNQYCVSCAVHLKAVRCRSAEGRKDRSNP
3D structure
PDB6zu5 Differences in structure and hibernation mechanism highlight diversification of the microsporidian ribosome.
ChainSAA
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sun Dec 1 15:03:11 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6zu5', asym_id = 'SAA', title = 'Differences in structure and hibernation mechani...t diversification of the microsporidian ribosome.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6zu5', asym_id='SAA', title='Differences in structure and hibernation mechani...t diversification of the microsporidian ribosome.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '6zu5', asym_id = 'SAA'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='6zu5', asym_id='SAA')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>