Structure of PDB 8xsy Chain SA

Receptor sequence

>8xsySA (length=221) Species: 9606 (Homo sapiens)

GALDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLK
RTWEKLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGR
FTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDS
PLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLY
FYRDPEEIEKEEQAAAEKAVT

3D structure

• PDB: 8xsy Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
• Chain: SA
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SA	F32 R41 R102 P105 T109 N110 Q132 E136 Y139 R155	F30 R39 R100 P103 T107 N108 Q130 E134 Y137 R153

Gene Ontology

Molecular Function

• GO:0001618 virus receptor activity
• GO:0003677 DNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005055 laminin receptor activity
• GO:0005515 protein binding
• GO:0043022 ribosome binding
• GO:0043236 laminin binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0007155 cell adhesion
• GO:0046718 symbiont entry into host cell
• GO:0140374 antiviral innate immune response

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0005886 plasma membrane
• GO:0016020 membrane
• GO:0022626 cytosolic ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0070062 extracellular exosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8xsy, PDBe:8xsy, PDBj:8xsy
• PDBsum: 8xsy
• PubMed: 38942792
• UniProt: P08865|RSSA_HUMAN Small ribosomal subunit protein uS2 (Gene Name=RPSA)