Structure of PDB 8fl0 Chain SA

Receptor sequence

>8fl0SA (length=274) Species: 9606 (Homo sapiens)

ARPLISVYSEKGESSGKNVTLPAVFKAPIRPDIVNFVHTNLRKRVNTTQK
RYAICSALAASALPALVMSKGHRIEEVPELPLVVEDKVEGYKKTKEAVLL
LKKLKAWNDIKKVYASRRGPCIIYNEDNGIIKAFRNIPGITLLNVSKLNI
LKLAPGGHVGRFCIWTESAFRKLDELYGTWRKAASLKSNYNLPMHKMINT
DLSRILKSPEIQRALRAPRKKIHRRVLKKNPLKNLRIMLKLNPYAKTMRR
NTILRQARNHKLRVDKAAAAAAAL

3D structure

• PDB: 8fl0 Principles of human pre-60 S biogenesis.
• Chain: SA
• Resolution: 2.91 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SA	A4 R33 I36 N38 R45 R114 N116 T117 T118 Q119 K140 K182 R204 K234 P242 G243 H245 K274 S275 R303 P305 R306 K307 I309 R311 R312 L314 K316 N321 L322 R323 K327 K333 R336 T339 Q343 N346 K353	A1 R30 I33 N35 R42 R44 N46 T47 T48 Q49 K70 K112 R117 K147 P155 G156 H158 K187 S188 R216 P218 R219 K220 I222 R224 R225 L227 K229 N234 L235 R236 K240 K246 R249 T252 Q256 N259 K266

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005791 rough endoplasmic reticulum
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0005925 focal adhesion
• GO:0016020 membrane
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:0070062 extracellular exosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8fl0, PDBe:8fl0, PDBj:8fl0
• PDBsum: 8fl0
• PubMed: 37410842
• UniProt: P36578|RL4_HUMAN Large ribosomal subunit protein uL4 (Gene Name=RPL4)