Structure of PDB 7qvp Chain SA

Receptor sequence
>7qvpSA (length=216) Species: 9606 (Homo sapiens) [Search protein sequence]
GALDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLK
RTWEKLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGR
FTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDS
PLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLY
FYRDPEEIEKEEQAAA
3D structure
PDB7qvp A distinct mammalian disome collision interface harbors K63-linked polyubiquitination of uS10 to trigger hRQT-mediated subunit dissociation.
ChainSA
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SA R41 R102 P105 T109 N110 Q132 Y139 R155 R39 R100 P103 T107 N108 Q130 Y137 R153
Gene Ontology
Molecular Function
GO:0001618 virus receptor activity
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005055 laminin receptor activity
GO:0005515 protein binding
GO:0043022 ribosome binding
GO:0043236 laminin binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0007155 cell adhesion
GO:0046718 symbiont entry into host cell
GO:0140374 antiviral innate immune response
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005886 plasma membrane
GO:0015935 small ribosomal subunit
GO:0016020 membrane
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0070062 extracellular exosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qvp, PDBe:7qvp, PDBj:7qvp
PDBsum7qvp
PubMed36302773
UniProtP08865|RSSA_HUMAN Small ribosomal subunit protein uS2 (Gene Name=RPSA)

[Back to BioLiP]