Structure of PDB 8iuf Chain S8

Receptor sequence
>8iufS8 (length=182) Species: 3039 (Euglena gracilis) [Search protein sequence]
PHPDVPKDVSGLGMGLAFMNQFLLKEIMKAMWIVTIYTFRQPSVTIHYPY
ERNTKSTRFRGEHALLIYPDGDERCITCQLCEVTCPAQAIAIDGVEDDDG
SRMASRFDLDMHKCIYCGLCQEACPVDAIVETPHAEFCSTEYDSLLYDKA
RLLENGIRWTSAIEYMVAKERSDFPTNSQRFK
3D structure
PDB8iuf Euglena's atypical respiratory chain adapts to the discoidal cristae and flexible metabolism.
ChainS8
Resolution2.81 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 S8 H92 C114 P115 I119 C143 I144 Y145 C146 G147 C149 E160 H63 C85 P86 I90 C114 I115 Y116 C117 G118 C120 E131
BS02 SF4 S8 C104 I105 T106 C107 Q108 C110 C153 I158 C75 I76 T77 C78 Q79 C81 C124 I129
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Tue Dec 3 03:32:16 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8iuf', asym_id = 'S8', title = "Euglena's atypical respiratory chain adapts to the discoidal cristae and flexible metabolism. "
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8iuf', asym_id='S8', title="Euglena's atypical respiratory chain adapts to the discoidal cristae and flexible metabolism. ")
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0016020,0016651,0051539', uniprot = '', pdbid = '8iuf', asym_id = 'S8'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016020,0016651,0051539', uniprot='', pdbid='8iuf', asym_id='S8')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>