Structure of PDB 8esz Chain S8

Receptor sequence
>8eszS8 (length=186) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
EPKDIVEVPKGYVYVNNKELSMEFADITDRAASTMFFGELLRGFAVTLAH
IFKEPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQ
AITIEAEERADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFS
TETHEELLYNKEKLLCNGDKWESEIASNLQADHLYR
3D structure
PDB8esz Resting mitochondrial complex I from Drosophila melanogaster adopts a helix-locked state.
ChainS8
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 7.1.1.2: NADH:ubiquinone reductase (H(+)-translocating).
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 S8 H106 C128 I133 C157 I158 Y159 C160 G161 C163 E174 H75 C97 I102 C126 I127 Y128 C129 G130 C132 E143
BS02 SF4 S8 C118 I119 A120 C121 K122 C124 Y150 C167 P168 I172 C87 I88 A89 C90 K91 C93 Y119 C136 P137 I141
Gene Ontology
Molecular Function
GO:0003954 NADH dehydrogenase activity
GO:0008137 NADH dehydrogenase (ubiquinone) activity
GO:0016491 oxidoreductase activity
GO:0016651 oxidoreductase activity, acting on NAD(P)H
GO:0046872 metal ion binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0006120 mitochondrial electron transport, NADH to ubiquinone
GO:0032981 mitochondrial respiratory chain complex I assembly
GO:0042775 mitochondrial ATP synthesis coupled electron transport
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0016020 membrane
GO:0045271 respiratory chain complex I

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8esz, PDBe:8esz, PDBj:8esz
PDBsum8esz
PubMed36952377
UniProtQ9VF27|NDUS8_DROME NADH dehydrogenase (ubiquinone) 23 kDa subunit (Gene Name=ND-23)

[Back to BioLiP]