Structure of PDB 6qbx Chain S8

Receptor sequence
>6qbxS8 (length=176) Species: 9940 (Ovis aries) [Search protein sequence]
TYKYVNLREPSMDMKSVTDRAAQTLLWTELIRGLGMTLSYLFREPATINY
PFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAVCPAQAITIEAEPRA
DGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYN
KEKLLNNGDKWEAEIAANIQADYLYR
3D structure
PDB6qbx Structures of Respiratory Supercomplex I+III2Reveal Functional and Conformational Crosstalk.
ChainS8
Resolution4.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 S8 H65 C87 P88 C116 I117 Y118 C119 C122 E133 H65 C87 P88 C116 I117 Y118 C119 C122 E133
BS02 SF4 S8 C77 I78 A79 C80 K81 C83 C126 P127 I131 C77 I78 A79 C80 K81 C83 C126 P127 I131
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Tue Nov 26 16:22:23 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6qbx', asym_id = 'S8', title = 'Structures of Respiratory Supercomplex I+III2Reveal Functional and Conformational Crosstalk.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6qbx', asym_id='S8', title='Structures of Respiratory Supercomplex I+III2Reveal Functional and Conformational Crosstalk.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0016020,0016651,0051539', uniprot = '', pdbid = '6qbx', asym_id = 'S8'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016020,0016651,0051539', uniprot='', pdbid='6qbx', asym_id='S8')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>