Structure of PDB 5y6p Chain S8

Receptor sequence
>5y6pS8 (length=331) Species: 35689 (Griffithsia pacifica) [Search protein sequence]
LGTVLGNSSLDKLGLDKFVDRFEVNEAGRPDGFSADYEVIIRACYMQIFA
NAYIMESERAEMAKAESEFRDGRFTVKEFCRALAKSYQYRKRFFDGRPLY
GAIELCFKHILGRTPDGLEHYRAKSAVYDTKGYEAFIDAFFDDGEYDAFY
DSYCVPFYRGHLTTSNLSMAAFTHMFQVVRGSSTSDKANPRTMTNQITLN
QAGIQSIPLAVVAPGADGATFLAPDASAGSWQTGFSGATKARTSHGSRQE
KGKMFRIEVANNTQYSAVGGGSGIKLQSRSGKFYKMRNMAPAKVSTFRRA
NNVYLVPFDELSATYIKIHKNGGSIASITPV
3D structure
PDB5y6p Structure of phycobilisome from the red alga Griffithsia pacifica
ChainS8
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PEB S8 N91 Y93 S225 N51 Y53 S185
BS02 PEB S8 F348 Y355 F308 Y315
BS03 PEB S8 S270 W271 H285 S230 W231 H245
BS04 PEB S8 Q304 Y305 S335 Q264 Y265 S295
BS05 PEB S8 S49 T203 M209 S9 T163 M169
BS06 PEB S8 K104 S107 E108 R110 K64 S67 E68 R70
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Dec 1 08:13:21 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5y6p', asym_id = 'S8', title = 'Structure of phycobilisome from the red alga Griffithsia pacifica'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5y6p', asym_id='S8', title='Structure of phycobilisome from the red alga Griffithsia pacifica')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0015979,0030089', uniprot = '', pdbid = '5y6p', asym_id = 'S8'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0015979,0030089', uniprot='', pdbid='5y6p', asym_id='S8')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>