Structure of PDB 5tcu Chain S8

Receptor sequence
>5tcuS8 (length=80) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
NDRKVYVGKVVSDKMDKTITVLVETYKTHKLYGKRVKYSKKYKTHDENNS
AKLGDIVKIQETRPLSATKRFRLVEIVEES
3D structure
PDB5tcu Structural Basis for Linezolid Binding Site Rearrangement in the Staphylococcus aureus Ribosome.
ChainS8
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S8 N5 D20 R39 K41 Y42 S43 K45 R67 L69 A71 T72 R74 N1 D16 R35 K37 Y38 S39 K41 R63 L65 A67 T68 R70
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5tcu, PDBe:5tcu, PDBj:5tcu
PDBsum5tcu
PubMed28487427
UniProtQ2FW15|RS17_STAA8 Small ribosomal subunit protein uS17 (Gene Name=rpsQ)

[Back to BioLiP]